Skip to content
The Woolly Gentleman logo

The Woolly Gentleman

Every Fly Has a River · Every River Has a Tier

ShopSubscribeOur TiersJournalFind Your FliesThe CraftThe Story
The Spring Playbook: First Hatches to Full Send — editorial fly fishing photography
Home/Journal/The Spring Playbook: First Hatches to Full Send
Seasonal Playbook14 min read

The Spring Playbook: First Hatches to Full Send

A seasonal guide to unlocking the best fishing of the year as winter releases its grip

SP

Shane Pierson

February 20, 2026

The Season of Transition

Spring does not arrive all at once. It seeps in — a degree at a time in the water column, a few extra minutes of daylight each week, a subtle shift in the angle of the sun that warms the south-facing banks just enough to trigger the first tentative insect activity. For the fly angler, spring is the most rewarding season to pay attention, because the fish are paying attention too. After months of reduced metabolism and limited feeding, trout enter spring in a caloric deficit. They have burned through fat reserves to survive winter, and the biological imperative to feed intensifies as water temperatures climb through the low forties into the fifties. Each degree matters. At 39 degrees, trout are sluggish and feed opportunistically. At 45 degrees, metabolic rates have roughly doubled and active feeding windows expand from minutes to hours. By the time water hits the mid-fifties, the engine is running at full capacity. This temperature-driven awakening creates a predictable progression of fishing opportunities that unfolds across regions from south to north and from low elevation to high. Understanding this progression — knowing which hatches to expect, which water to target, and how to adjust your approach as conditions evolve — is the key to making spring your most productive season.
“

Every degree of warming doubles the urgency. Spring is not a season — it is a countdown, and the angler who understands the sequence fishes the best water at the best time, every time.

🧪The Temperature Threshold: Why 45 Degrees Changes Everything

The magic number in spring trout fishing is 45 degrees Fahrenheit. Below this temperature, trout metabolism operates at roughly twenty percent of maximum capacity. Feeding activity is sporadic, limited to short windows during the warmest part of the day, and fish position themselves in slow, deep water that requires the least energy expenditure. Your nymphs need to be drifted within inches of the bottom, at the slowest possible speed, to generate interest. As water temperature crosses the 45-degree threshold, a cascade of biological changes accelerates. Trout metabolic rates increase sharply, and with them the caloric demand that drives active feeding. Equally important, insect emergence begins in earnest. Baetis mayflies (Blue-Winged Olives) are among the first to hatch, with emergence triggered by water temperatures in the 45-50 degree range. Midges, which hatch year-round, increase dramatically in density. And the first stoneflies begin crawling to shore to emerge, providing large, protein-rich meals that draw trout to the banks. This convergence — hungry fish and abundant food — creates the classic spring fishing pattern. The best action occurs during the warmest hours, typically from noon to 4 PM, when water temperatures peak and insect activity is highest. Morning and evening fishing, which dominate the summer calendar, are often unproductive in early spring. Save your energy for the afternoon and fish when the fish are eating.

Rocky Mountain Spring: BWOs and Midges

Spring on Rocky Mountain tailwaters and freestone rivers revolves around two insect families: Baetis (Blue-Winged Olives) and Chironomidae (midges). The BWO hatch is the defining event of early spring — clouds of size 18-22 mayflies emerging on overcast, drizzly afternoons that bring every trout in the river to the surface. Carry the full lifecycle: Juju Baetis and Pheasant Tail nymphs for the subsurface game, Barr's Emerger and CDC Transitional patterns for the film, and Sparkle Duns and Blue-Winged Olive dries for the surface. RS2 emergers cover the midge transition, and Zebra Midges handle the subsurface midge game. San Juan Worms in red and wine round out the early season box — aquatic worms are dislodged during spring runoff and trout eat them with abandon.

Blue Wing Olive (BWO)
Blue Wing Olive (BWO)$2.95
dryintermediate

Mayfly imitation for Baetis hatches. Olive body, dark dun wings. The cold-weather dry fly that saves slow days.

Juju Baetis
Juju Baetis$3.50
nymphintermediate

Charlie Craven's modern Baetis nymph. Flashback wing case, tungsten bead, slim profile. The go-to nymph for Blue Wing Olive hatches.

Pheasant Tail Nymph
Pheasant Tail Nymph$2.95
nymphbeginner

Frank Sawyer's original, perfected by American tiers. Pheasant tail fiber body, copper wire rib. The most important nymph ever tied.

Barr's Emerger (BWO)
Barr's Emerger (BWO)$3.95
emergerintermediate

John Barr's Blue Wing Olive emerger. Tungsten bead, trailing shuck, CDC wing. Designed for the transition zone between nymph and dun.

CDC Transitional Dun
CDC Transitional Dun$3.95
emergeradvanced

A hybrid emerger-dun pattern with CDC wings and a trailing nymphal shuck. Sits half-in, half-out of the surface film.

Sparkle Dun
Sparkle Dun$3.50
dryintermediate

Craig Mathews' flush-floating mayfly emerger. Deer hair wing, trailing Z-lon shuck. Sits in the film like a natural.

RS2
RS2$2.95
emergerintermediate

Rim Chung's minimalist emerger. CDC or beaver fur wing, thread body. Imitates emerging Baetis and midges in the surface film.

Zebra Midge
Zebra Midge$2.95
nymphbeginner

Thread body with wire rib and a bead head. The essential winter tailwater pattern. Simple, small, and devastatingly effective.

San Juan Worm
San Juan Worm$2.95
nymphbeginner

Simple chenille worm pattern named for the San Juan River. Red, brown, or pink. The fly that purists love to hate and fish love to eat.

Driftless Spring: The Scud and BWO Double Feature

Spring arrives early in the Driftless Area, thanks to the constant 48-54 degree water temperatures of its spring-fed creeks. While Rocky Mountain streams are still locked in ice, Driftless anglers are catching trout on Blue-Winged Olive dries as early as March. The spring-fed nature of these creeks means they rarely experience the dramatic runoff that shuts down freestone rivers — they are fishable all spring, every day. The early season strategy is straightforward: fish Driftless Scuds in olive and pink and Sow Bugs in the morning when trout are holding deep, then switch to BWO nymphs and dries as the afternoon hatch develops. Zebra Midges and Pheasant Tails cover the nymph base, while Blue-Winged Olive dries in sizes 18-20 and Hare's Ear nymphs become primary patterns as hatches intensify. As April progresses into May, the insect diversity expands — Hendricksons, Sulphurs, and caddis join the menu, and the Driftless transitions from a nymphing game to a dry-fly paradise.

Driftless Scud
Driftless Scud$3.50
nymphbeginner

Curved-hook scud pattern for spring creek trout. Olive or pink. The daily bread of Driftless brown trout.

Sow Bug
Sow Bug$3.50
nymphbeginner

Isopod imitation for spring creek trout. Flat, segmented body with antennae. A staple food source in limestone-rich waters.

Zebra Midge
Zebra Midge$2.95
nymphbeginner

Simple thread-body midge pupa with a bead head. Deadly in winter and early spring when midges dominate the drift.

Pheasant Tail Nymph
Pheasant Tail Nymph$3.50
nymphbeginner

The universal mayfly nymph. Pheasant tail fibers over copper wire. Imitates Baetis, PMDs, and most small mayfly nymphs.

Blue Wing Olive
Blue Wing Olive$2.95
dryintermediate

Small mayfly imitation matching Baetis hatches. The most reliable hatch on Driftless spring creeks, especially on overcast days.

Gold-Ribbed Hare's Ear
Gold-Ribbed Hare's Ear$3.50
nymphbeginner

Buggy, impressionistic nymph tied from hare's ear fur. Imitates mayflies, caddis pupae, and assorted creek debris.

🎣Northeast Spring: Stripers, Shad, and the Herring Runs

While trout anglers focus on hatches, the Northeast spring is defined by the great anadromous migrations. Striped bass begin pushing into estuaries and tidal rivers from Maryland to Maine as water temperatures reach the low fifties, following schools of herring, alewives, and shad on their spawning runs. Hickory shad and American shad provide outstanding fly-rod sport on rivers like the Connecticut, Delaware, and Potomac. The key to spring striper fishing is finding the bait. Locate the herring run — check local reports for river temperatures and migration timing — and the stripers will be nearby. Fish Deceivers, Clouser Minnows, and Surf Candy patterns that match the size and profile of the juvenile baitfish. Early morning and evening tides concentrate fish at chokepoints — bridge abutments, jetty tips, and river mouths where current funnels bait into ambush zones. For shad, the technique is similar to steelhead fishing: cast across the current and swing bright, flashy flies (Hickory Shad Flies in chartreuse, pink, and white) through the runs where fish are staging. Shad hit with a distinctive tapping take and fight far above their weight, with powerful runs and head-shaking leaps that will test a 6-weight outfit.

Northeast Saltwater and Shad Patterns

Spring in the Northeast is all about matching the bait migrations. Deceiver patterns in white, olive, and herring colors are the workhorse striper flies — versatile, easy to cast, and deadly when stripers are feeding on schooling baitfish. Clouser Minnows in chartreuse-and-white fish deeper in the water column for fish holding near the bottom of tidal rips. Surf Candy patterns provide a more realistic baitfish profile for educated fish in clear water. Hickory Shad Flies round out the spring arsenal for the shad runs that provide some of the best pound-for-pound fighting on a fly rod.

Striper Deceiver
Striper Deceiver$8.95
baitfishintermediate

Oversized Deceiver tied for Northeast stripers. Long white saddle hackle with flash. The workhorse of the striper fleet and the first fly every Northeast saltwater angler learns to love.

Northeast Clouser Minnow
Northeast Clouser Minnow$6.95
baitfishbeginner

The universal Clouser adapted for Northeast waters. Lead eyes sink it into the strike zone in estuaries and back bays. Chartreuse/white is the classic, but olive/white imitates the local sand eels.

Surf Candy
Surf Candy$8.50
baitfishintermediate

Epoxy-coated baitfish imitation. Nearly indestructible. Sinks fast and flashes through the water column. The bluefish-proof fly.

Hickory Shad Fly
Hickory Shad Fly$5.95
attractorbeginner

A small, flashy wet fly designed for the spring hickory shad runs in Mid-Atlantic rivers. Shad flies are attractor patterns -- the fish are not feeding, but they will strike out of aggression.

Pacific Northwest Spring: Steelhead and the First Caddis

Spring in the Pacific Northwest means two things: the tail end of the winter steelhead season and the beginning of the trout year. From February through April, late-run winter steelhead still move through rivers like the Skagit, Hoh, and Deschutes. Intruder-style flies in pink, orange, and purple are the standard swung steelhead patterns — large, articulated, and designed to pulse and breathe in heavy current. Egg-Sucking Leeches and Marabou Spey flies provide smaller-profile options for pressured fish or clear water. As steelhead season winds down and water temperatures climb into the fifties, the region's resident trout fisheries come alive. Pheasant Tail nymphs, Stonefly Nymphs, and Elk Hair Caddis cover the emerging insect activity. By May, Mother's Day caddis hatches blanket rivers from Oregon to British Columbia. Soft Hackle patterns in hare's ear and partridge are the secret weapon during caddis hatches — fished on a tight line in the surface film, they draw slashing takes from feeding trout.

The Intruder
The Intruder$11.95
streameradvanced

The modern steelhead fly. Long shank, trailing hook, maximum movement. Swung on a spey rod through winter runs.

Egg Sucking Leech
Egg Sucking Leech$4.95
streamerbeginner

Marabou leech with a fluorescent egg head. Dead-drifted or swung. Catches everything that swims in the Pacific Northwest.

Marabou Spey
Marabou Spey$7.95
wetintermediate

Simplified spey fly using marabou instead of traditional heron or blue-eared pheasant. Maximum movement, minimal materials.

Pheasant Tail Nymph (PNW)
Pheasant Tail Nymph (PNW)$2.95
nymphbeginner

Bead head Pheasant Tail sized for PNW waters. Heavier bead and sturdier hook for steelhead-strength currents and trout with shoulders.

Kaufmann's Stonefly Nymph
Kaufmann's Stonefly Nymph$4.95
nymphintermediate

Randall Kaufmann's realistic stonefly nymph. Turkey tail shell back, dubbed body, rubber legs. Designed on Oregon's Deschutes River.

Elk Hair Caddis (PNW variant)
Elk Hair Caddis (PNW variant)$2.95
drybeginner

Standard Elk Hair Caddis in larger sizes for PNW rivers. Heavier elk hair wing for buoyancy in heavy water. The caddis are bigger here.

Soft Hackle
Soft Hackle$3.95
wetbeginner

Traditional wet fly with a partridge or hen hackle collar. Thread or floss body. Swung downstream, it imitates emerging insects across species.

Tags

springseasonalhatchesblue-winged-olivesteelheademergernymphdry-fly

Regions Covered

Rocky MountainMidwest DriftlessNortheastPacific Northwest

In This Article

  • The Season of Transition
  • The Temperature Threshold: Why 45 Degrees Changes Everything
  • Rocky Mountain Spring: BWOs and Midges
  • Driftless Spring: The Scud and BWO Double Feature
  • Northeast Spring: Stripers, Shad, and the Herring Runs
  • Northeast Saltwater and Shad Patterns
  • Pacific Northwest Spring: Steelhead and the First Caddis

Tags

springseasonalhatchesblue-winged-olivesteelheademergernymphdry-fly

Regions Covered

Rocky MountainMidwest DriftlessNortheastPacific Northwest

Related Reading

The Fall Guide: Changing Seasons, Changing Tactics

15 min read

The Winter Guide: Cold Water, Warm Hands, Willing Fish

13 min read

Emerger Patterns: Fishing the In-Between

12 min read

Continue Reading

You Might Also Enjoy

The Fall Guide: Changing Seasons, Changing Tactics — editorial fly fishing photographySeasonal Playbook15 min read

The Fall Guide: Changing Seasons, Changing Tactics

From spawning browns to migrating stripers, October caddis to steelhead push — the comprehensive playbook for fly fishing's most dynamic season

Fall is when the fishing world rearranges itself. Brown trout become aggressive and territorial as spawning urges override caution. Steelhead push into Pacific Northwest rivers on autumn rain. Striped bass blitz baitfish along the Northeast coast. And trout streams that were too warm in August cool into prime condition. Here's how to fish every opportunity the changing season offers.

fallseasonalbrown-troutsteelhead
Shane PiersonSep 25, 2025
The Winter Guide: Cold Water, Warm Hands, Willing Fish — editorial fly fishing photographySeasonal Playbook13 min read

The Winter Guide: Cold Water, Warm Hands, Willing Fish

Midges, slow nymphs, and the quiet beauty of empty rivers — a complete guide to fly fishing through the coldest months

Winter separates the dedicated from the fair-weather crowd. The rivers are empty, the hatches are tiny, and the fish feed in slow motion. But they do feed — they have to. And the angler who understands cold-water metabolism, midge biology, and the art of slowing down will find winter fishing not just productive but deeply rewarding.

winterseasonalmidgecold-water
Shane PiersonDec 20, 2025
Emerger Patterns: Fishing the In-Between — editorial fly fishing photographyHatch Guide12 min read

Emerger Patterns: Fishing the In-Between

Why the most productive fly in your box imitates an insect caught between two worlds

Trout eat more insects during emergence than at any other stage. Emerger patterns — flies that imitate the critical moment when a nymph transforms into an adult in the surface film — are the most consistently effective dry flies in fly fishing. Here is the science and the technique behind fishing the in-between.

emergersurface-filmhatch-guidedry-fly
Shane PiersonOct 15, 2025

The Woolly Gentleman

Every Fly Has a River · Every River Has a Tier

America's curated artisan fly marketplace. Every pattern hand-tied by the people who fish these waters.

Join the mailing list. We will tell you what is hatching.

The Shop

  • Browse All Flies
  • Our Tiers
  • Find Your Flies
  • The Collection
  • Monthly Delivery
  • The Journal

Fishing Regions

  • Gulf Coast & Emerald Coast
  • Florida Keys
  • Northeast & Mid-Atlantic
  • Rocky Mountain West
  • Pacific Northwest
  • All 10 Regions

The Gentleman

  • Our Story
  • Nationwide
  • hello@thewoolygentleman.com

© 2026 The Woolly Gentleman. All rights reserved.

Privacy Policy|Terms & Conditions

Curated with conviction. Tied with pride.